Recombinant Human Phospholipase A2/PLA2G1B Protein

Catalog Number: ABB-RP03277
Article Name: Recombinant Human Phospholipase A2/PLA2G1B Protein
Biozol Catalog Number: ABB-RP03277
Supplier Catalog Number: RP03277
Alternative Catalog Number: ABB-RP03277-10UG,ABB-RP03277-50UG,ABB-RP03277-100UG,ABB-RP03277-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ser148
Alternative Names: Phospholipase A2, PLA2G1B, PLA2, PLA2A, PPLA2
Phospholipase A2 (PLA2) plays crucial roles in diverse cellular responses, including phospholipid digestion and metabolism, host defense and signal transduction. PLA2 provides precursors for generation of eicosanoids, such as prostaglandins (PGs) and leukotrienes (LTs), when the cleaved fatty acid is arachidonic acid, platelet-activating factor (PAF) when the sn-1 position of the phosphatidylcholine contains an alkyl ether linkage and some bioactive lysophospholipids, such as lysophosphatidic acid (lysoPA).
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 17.20 kDa
NCBI: 5319
UniProt: P04054
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 10 mM Tris, 5 mM CaCl2, pH 8.0. Contact us for customized product form or formulation.
Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Target: PLA2G1B
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 10 mM Tris, 5 mM CaCl2, pH 8.0. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Please contact us for reconstitution instructions. ResearchArea: Other Recombinant Protein