Recombinant Mouse MMR/CD206 Protein, Human

Artikelnummer: ABB-RP03284
Artikelname: Recombinant Mouse MMR/CD206 Protein, Human
Artikelnummer: ABB-RP03284
Hersteller Artikelnummer: RP03284
Alternativnummer: ABB-RP03284-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Leu20-Ala1388
Alternative Synonym: MMR, CD206, hMR, MRC1, CLEC13D, CLEC13DL, MRC1L1, Macrophage mannose receptor 1
Mannose receptor (also known as CD206) is a highly glycosylated type I transmembrane protein that is mainly present on the surface of macrophages, dendritic cells and avascular endothelial cells. CD206 can mediate the internalization of soluble and granular carbohydrate structures, thereby participating in innate immunity. And CD206 binds sulfated and non-sulfated polysaccharide chains through macrophage-mediated endocytosis of glycoproteins. It also acts as a phagocytic receptor for bacteria, fungi and other pathogens or a receptor for dengue virus envelope protein E.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 157.3 kDa
NCBI: 17533
UniProt: Q61830
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: LDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNANGAVCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFEGSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLS
Target-Kategorie: MMR/CD206
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens
Recombinant Mouse MMR/CD206 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.