Recombinant Mouse MMR/CD206 Protein, Human

Catalog Number: ABB-RP03284
Article Name: Recombinant Mouse MMR/CD206 Protein, Human
Biozol Catalog Number: ABB-RP03284
Supplier Catalog Number: RP03284
Alternative Catalog Number: ABB-RP03284-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Leu20-Ala1388
Alternative Names: MMR, CD206, hMR, MRC1, CLEC13D, CLEC13DL, MRC1L1, Macrophage mannose receptor 1
Mannose receptor (also known as CD206) is a highly glycosylated type I transmembrane protein that is mainly present on the surface of macrophages, dendritic cells and avascular endothelial cells. CD206 can mediate the internalization of soluble and granular carbohydrate structures, thereby participating in innate immunity. And CD206 binds sulfated and non-sulfated polysaccharide chains through macrophage-mediated endocytosis of glycoproteins. It also acts as a phagocytic receptor for bacteria, fungi and other pathogens or a receptor for dengue virus envelope protein E.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 157.3 kDa
NCBI: 17533
UniProt: Q61830
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: LDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNANGAVCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFEGSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLS
Target: MMR/CD206
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens
Recombinant Mouse MMR/CD206 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.