Recombinant Mouse CD55 Protein, Human

Artikelnummer: ABB-RP03522
Artikelname: Recombinant Mouse CD55 Protein, Human
Artikelnummer: ABB-RP03522
Hersteller Artikelnummer: RP03522
Alternativnummer: ABB-RP03522-10UG, ABB-RP03522-100UG, ABB-RP03522-50UG, ABB-RP03522-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Asp35-Gly362
Alternative Synonym: Cd55, Cd55a, Daf, Daf1,Complement decay-accelerating factor, GPI-anchored, DAF-GPI, CD55
Recombinant Mouse CD55 Protein is a major regulator of the alternative and classical pathways of complement activation and is expressed on all serum-exposed cells.This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 36.63 KDa
NCBI: 13136
UniProt: Q61475
Reinheit: 90% as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Sequenz: DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSK
Target-Kategorie: Cd55, Cd55a, Daf, Daf1
Application Verdünnung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens