Recombinant Mouse CD55 Protein, Human

Catalog Number: ABB-RP03522
Article Name: Recombinant Mouse CD55 Protein, Human
Biozol Catalog Number: ABB-RP03522
Supplier Catalog Number: RP03522
Alternative Catalog Number: ABB-RP03522-10UG, ABB-RP03522-100UG, ABB-RP03522-50UG, ABB-RP03522-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Asp35-Gly362
Alternative Names: Cd55, Cd55a, Daf, Daf1,Complement decay-accelerating factor, GPI-anchored, DAF-GPI, CD55
Recombinant Mouse CD55 Protein is a major regulator of the alternative and classical pathways of complement activation and is expressed on all serum-exposed cells.This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 36.63 KDa
NCBI: 13136
UniProt: Q61475
Purity: 90% as determined by reducing SDS-PAGE.
Form: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Sequence: DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSK
Target: Cd55, Cd55a, Daf, Daf1
Application Dilute: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens