Recombinant Human Nephrin Protein

Produktübersicht

• Artikelname: Recombinant Human Nephrin Protein
• Artikelnummer: ABB-RP03532
• Hersteller Artikelnummer: RP03532
• Alternativnummer: ABB-RP03532-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Ser1055
• Alternative Synonym: NPHS1, NPHN,Nephrin, Renal glomerulus-specific cell adhesion receptor

Produktbeschreibung

Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 113.07 kDa
• NCBI: 4868
• UniProt: O60500
• Reinheit: 90 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
• Sequenz: MALGTTLRASLLLLGLLTEGLAQLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHV
• Target-Kategorie: NPHS1, NPHN

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from sterile PBS, pH 7.4.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein