Recombinant Human Nephrin Protein

Catalog Number: ABB-RP03532
Article Name: Recombinant Human Nephrin Protein
Biozol Catalog Number: ABB-RP03532
Supplier Catalog Number: RP03532
Alternative Catalog Number: ABB-RP03532-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ser1055
Alternative Names: NPHS1, NPHN,Nephrin, Renal glomerulus-specific cell adhesion receptor
Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 113.07 kDa
NCBI: 4868
UniProt: O60500
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Sequence: MALGTTLRASLLLLGLLTEGLAQLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHV
Target: NPHS1, NPHN
Application Dilute: Lyophilized from sterile PBS, pH 7.4.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human Nephrin Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.