Recombinant Human Atrophin-1 interacting protein 4/ITCH protein, E. coli

Artikelnummer: ABB-RP10137LQ
Artikelname: Recombinant Human Atrophin-1 interacting protein 4/ITCH protein, E. coli
Artikelnummer: ABB-RP10137LQ
Hersteller Artikelnummer: RP10137LQ
Alternativnummer: ABB-RP10137LQ-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser2-Glu903
Alternative Synonym: ITCH, E3 ubiquitin-protein ligase Itchy homolog, Itch, EC:2.3.2.26, Atrophin-1-interacting protein 4, AIP4, HECT-type E3 ubiquitin transferase Itchy homolog, NFE2-associated polypeptide 1, NAPP1
ITCH, also called atrophin-1 interacting protein 4 (AIP4), is a HECT-type E3 ubiquitin ligase. It contains an N-terminal Ca
Konzentration: Please contact us for more information.
Molekulargewicht: 102.67 KDa
NCBI: 83737
UniProt: Q96J02
Reinheit: 90% as determined by reducing SDS-PAGE.
Formulierung: 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: SDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNLCLPGLSDSPISASRVAGFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRP
Target-Kategorie: ITCH
Application Verdünnung: 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: ResearchArea: Cytokines & Cytokine receptors
Recombinant Human Atrophin-1 interacting protein 4/ITCH protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.