Recombinant Human Atrophin-1 interacting protein 4/ITCH protein, E. coli
Artikelnummer:
ABB-RP10137LQ
| Artikelname: |
Recombinant Human Atrophin-1 interacting protein 4/ITCH protein, E. coli |
| Artikelnummer: |
ABB-RP10137LQ |
| Hersteller Artikelnummer: |
RP10137LQ |
| Alternativnummer: |
ABB-RP10137LQ-50UG |
| Hersteller: |
ABclonal |
| Wirt: |
E. coli |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Ser2-Glu903 |
| Alternative Synonym: |
ITCH, E3 ubiquitin-protein ligase Itchy homolog, Itch, EC:2.3.2.26, Atrophin-1-interacting protein 4, AIP4, HECT-type E3 ubiquitin transferase Itchy homolog, NFE2-associated polypeptide 1, NAPP1 |
| ITCH, also called atrophin-1 interacting protein 4 (AIP4), is a HECT-type E3 ubiquitin ligase. It contains an N-terminal Ca
|
| Konzentration: |
Please contact us for more information. |
| Molekulargewicht: |
102.67 KDa |
| NCBI: |
83737 |
| UniProt: |
Q96J02 |
| Reinheit: |
90% as determined by reducing SDS-PAGE. |
| Formulierung: |
0.22 µm filtered solution of PBS, pH 7.4. |
| Sequenz: |
SDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNLCLPGLSDSPISASRVAGFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRP |
| Target-Kategorie: |
ITCH |
| Application Verdünnung: |
0.22 µm filtered solution of PBS, pH 7.4. |
| Anwendungsbeschreibung: |
ResearchArea: Cytokines & Cytokine receptors |
|
Recombinant Human Atrophin-1 interacting protein 4/ITCH protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue. |