Recombinant Human Atrophin-1 interacting protein 4/ITCH protein, E. coli
Catalog Number:
ABB-RP10137LQ
| Article Name: |
Recombinant Human Atrophin-1 interacting protein 4/ITCH protein, E. coli |
| Biozol Catalog Number: |
ABB-RP10137LQ |
| Supplier Catalog Number: |
RP10137LQ |
| Alternative Catalog Number: |
ABB-RP10137LQ-50UG |
| Manufacturer: |
ABclonal |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Immunogen: |
Ser2-Glu903 |
| Alternative Names: |
ITCH, E3 ubiquitin-protein ligase Itchy homolog, Itch, EC:2.3.2.26, Atrophin-1-interacting protein 4, AIP4, HECT-type E3 ubiquitin transferase Itchy homolog, NFE2-associated polypeptide 1, NAPP1 |
| ITCH, also called atrophin-1 interacting protein 4 (AIP4), is a HECT-type E3 ubiquitin ligase. It contains an N-terminal Ca
|
| Concentration: |
Please contact us for more information. |
| Molecular Weight: |
102.67 KDa |
| NCBI: |
83737 |
| UniProt: |
Q96J02 |
| Purity: |
90% as determined by reducing SDS-PAGE. |
| Form: |
0.22 µm filtered solution of PBS, pH 7.4. |
| Sequence: |
SDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNLCLPGLSDSPISASRVAGFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRP |
| Target: |
ITCH |
| Application Dilute: |
0.22 µm filtered solution of PBS, pH 7.4. |
| Application Notes: |
ResearchArea: Cytokines & Cytokine receptors |
