Recombinant Schistosoma japonicum GST Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Schistosoma japonicum GST Protein, E. coli
• Artikelnummer: ABB-RPT0001
• Hersteller Artikelnummer: RPT0001
• Alternativnummer: ABB-RPT0001-100UG,ABB-RPT0001-1000UG,ABB-RPT0001-500UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Plant
• Immunogen: Met1-Lys218
• Alternative Synonym: GST, GST 26, Sj26 antigen, SjGST

Produktbeschreibung

GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.

Produkteigenschaften

• Konzentration: Please contact us for more information.
• Molekulargewicht: 25.50 kDa
• UniProt: P08515
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
• Target-Kategorie: GST

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Tool proteins