Recombinant Schistosoma japonicum GST Protein, E. coli

Product Overview

• Article Name: Recombinant Schistosoma japonicum GST Protein, E. coli
• Biozol Catalog Number: ABB-RPT0001
• Supplier Catalog Number: RPT0001
• Alternative Catalog Number: ABB-RPT0001-100UG, ABB-RPT0001-500UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Plant
• Immunogen: Met1-Lys218
• Alternative Names: GST, GST 26, Sj26 antigen, SjGST

Product Description

GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.

Product Properties

• Concentration: Please contact us for more information.
• Molecular Weight: 25.50 kDa
• UniProt: P08515
• Purity: 95 % as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
• Target: GST

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Tool proteins