Recombinant Schistosoma japonicum GST-His Protein, E. coli

Artikelnummer: ABB-RPT0002
Artikelname: Recombinant Schistosoma japonicum GST-His Protein, E. coli
Artikelnummer: ABB-RPT0002
Hersteller Artikelnummer: RPT0002
Alternativnummer: ABB-RPT0002-100UG, ABB-RPT0002-500UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Immunogen: Met1-Lys218
Alternative Synonym: GST 26,Sj26 antigen,SjGST
Genetic engineers have used glutathione S-transferase to create the GST gene fusion system. This system is used to purify and detect proteins of interest. In a GST gene fusion system, the GST sequence is incorporated into an expression vector alongside the gene sequence encoding the protein of interest. Induction of protein expression from the vectors promoter results in expression of a fusion protein: the protein of interest fused to the GST protein. This GST-fusion protein can then be purified from cells via its high affinity for glutathione. GST is commonly used to create fusion proteins. The tag has the size of 22amino acids(roughly 26 KDa), which, compared to other tags like the Myc-or the FLAG-tag, is quite big. However, many commercially-available sources of GST-tagged plasmids include athrombindomain for cleavage of the GST tag during protein purification.
Konzentration: Please contact us for more information.
Molekulargewicht: 26.34 kDa
UniProt: P08515
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Target-Kategorie: GST
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: ResearchArea: Tool proteins