Recombinant Schistosoma japonicum GST-His Protein, E. coli

Catalog Number: ABB-RPT0002
Article Name: Recombinant Schistosoma japonicum GST-His Protein, E. coli
Biozol Catalog Number: ABB-RPT0002
Supplier Catalog Number: RPT0002
Alternative Catalog Number: ABB-RPT0002-100UG, ABB-RPT0002-500UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Immunogen: Met1-Lys218
Alternative Names: GST 26,Sj26 antigen,SjGST
Genetic engineers have used glutathione S-transferase to create the GST gene fusion system. This system is used to purify and detect proteins of interest. In a GST gene fusion system, the GST sequence is incorporated into an expression vector alongside the gene sequence encoding the protein of interest. Induction of protein expression from the vectors promoter results in expression of a fusion protein: the protein of interest fused to the GST protein. This GST-fusion protein can then be purified from cells via its high affinity for glutathione. GST is commonly used to create fusion proteins. The tag has the size of 22amino acids(roughly 26 KDa), which, compared to other tags like the Myc-or the FLAG-tag, is quite big. However, many commercially-available sources of GST-tagged plasmids include athrombindomain for cleavage of the GST tag during protein purification.
Concentration: Please contact us for more information.
Molecular Weight: 26.34 kDa
UniProt: P08515
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Target: GST
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: ResearchArea: Tool proteins