Recombinant Streptococcus SPG/IgG-binding protein G Protein
Artikelnummer:
ABB-RPT0009LQ
| Artikelname: |
Recombinant Streptococcus SPG/IgG-binding protein G Protein |
| Artikelnummer: |
ABB-RPT0009LQ |
| Hersteller Artikelnummer: |
RPT0009LQ |
| Alternativnummer: |
ABB-RPT0009LQ-100UG,ABB-RPT0009LQ-50UG,ABB-RPT0009LQ-500UG |
| Hersteller: |
ABclonal |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Bacteria |
| Immunogen: |
Leu190-Lys384 |
| Alternative Synonym: |
Immunoglobulin G-binding protein G, IgG-binding protein G, SPG |
| Tag: |
C-His |
| UniProt: |
P19909 |
| Quelle: |
E. coli |
| Reinheit: |
> 95% by SDS-PAGE. |
| Formulierung: |
Supplied as a 0.22 µm filtered solution in PBS, pH 7.4. |
| Sequenz: |
LDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLK |
| Target-Kategorie: |
SPG/IgG-binding protein G |
| Application Verdünnung: |
Supplied as a 0.22 µm filtered solution in PBS, pH 7.4. |
| Anwendungsbeschreibung: |
< 1.0 EU/µg of the protein by LAL method. |
