Recombinant Streptococcus SPG/IgG-binding protein G Protein, E. coli

Artikelnummer: ABB-RPT0009LQ
Artikelname: Recombinant Streptococcus SPG/IgG-binding protein G Protein, E. coli
Artikelnummer: ABB-RPT0009LQ
Hersteller Artikelnummer: RPT0009LQ
Alternativnummer: ABB-RPT0009LQ-500UG, ABB-RPT0009LQ-50UG, ABB-RPT0009LQ-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Immunogen: Leu190-Lys384
Alternative Synonym: Immunoglobulin G-binding protein G, IgG-binding protein G, SPG
Protein G is a bacterial protein derived from the cell wall of certain strains of b-hemolytic Streptococcci. It binds with high affinity to the Fc portion of various classes and subclasses of immunoglobulins from a variety of species. Protein G binds to all IgG subclasses from human, mouse and rat species. It also binds to total IgG from guinea pig, rabbit, goat, cow, sheep, and horse. Protein G binds preferentially to the Fc portion of IgG, but can also bind to the Fab region, making it useful for purification of F(ab) fragments of IgG. Due to its affinity for the Fc region of many mammalian immunoglobulins, protein G is considered a universal reagent in biochemistry and immunology.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 22.17 kDa
UniProt: P19909
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4.
Sequenz: LDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLK
Target-Kategorie: SPG/IgG-binding protein G
Application Verdünnung: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4.
Anwendungsbeschreibung: ResearchArea: Tool proteins