Recombinant Streptococcus SPG/IgG-binding protein G Protein, E. coli

Catalog Number: ABB-RPT0009LQ
Article Name: Recombinant Streptococcus SPG/IgG-binding protein G Protein, E. coli
Biozol Catalog Number: ABB-RPT0009LQ
Supplier Catalog Number: RPT0009LQ
Alternative Catalog Number: ABB-RPT0009LQ-500UG, ABB-RPT0009LQ-50UG, ABB-RPT0009LQ-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Immunogen: Leu190-Lys384
Alternative Names: Immunoglobulin G-binding protein G, IgG-binding protein G, SPG
Protein G is a bacterial protein derived from the cell wall of certain strains of b-hemolytic Streptococcci. It binds with high affinity to the Fc portion of various classes and subclasses of immunoglobulins from a variety of species. Protein G binds to all IgG subclasses from human, mouse and rat species. It also binds to total IgG from guinea pig, rabbit, goat, cow, sheep, and horse. Protein G binds preferentially to the Fc portion of IgG, but can also bind to the Fab region, making it useful for purification of F(ab) fragments of IgG. Due to its affinity for the Fc region of many mammalian immunoglobulins, protein G is considered a universal reagent in biochemistry and immunology.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 22.17 kDa
UniProt: P19909
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4.
Sequence: LDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLK
Target: SPG/IgG-binding protein G
Application Dilute: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4.
Application Notes: ResearchArea: Tool proteins