Recombinant Yeast sumo Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Yeast sumo Protein, E. coli
• Artikelnummer: ABB-RPT0010
• Hersteller Artikelnummer: RPT0010
• Alternativnummer: ABB-RPT0010-500UG, ABB-RPT0010-50UG, ABB-RPT0010-100UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Yeast
• Immunogen: Met1-Gly98
• Alternative Synonym: sumo

Produkteigenschaften

• Konzentration: < 0.1 EU/µg of the protein by LAL method.
• Molekulargewicht: 11.26 kDa
• NCBI: 852122
• UniProt: Q12306
• Reinheit: 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
• Target-Kategorie: sumo

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Tool proteins