Recombinant Yeast sumo Protein, E. coli

Product Overview

• Article Name: Recombinant Yeast sumo Protein, E. coli
• Biozol Catalog Number: ABB-RPT0010
• Supplier Catalog Number: RPT0010
• Alternative Catalog Number: ABB-RPT0010-500UG, ABB-RPT0010-50UG, ABB-RPT0010-100UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Yeast
• Immunogen: Met1-Gly98
• Alternative Names: sumo

Product Properties

• Concentration: < 0.1 EU/µg of the protein by LAL method.
• Molecular Weight: 11.26 kDa
• NCBI: 852122
• UniProt: Q12306
• Purity: 95% as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
• Target: sumo

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Tool proteins