Anti-TOMM22/TOM22 Antibody [ARC1688], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306788-100
Artikelname: Anti-TOMM22/TOM22 Antibody [ARC1688], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306788-100
Hersteller Artikelnummer: A306788-100
Alternativnummer: ABC-A306788-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOMM22 (Q9NS69).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1688] antibody to TOMM22/TOM22.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC1688]
Molekulargewicht: 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV
Target-Kategorie: TOMM22/TOM22
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:500-1:1,000