Anti-TOMM22/TOM22 Antibody [ARC1688], Unconjugated, Rabbit, Monoclonal

Catalog Number: ABC-A306788-100
Article Name: Anti-TOMM22/TOM22 Antibody [ARC1688], Unconjugated, Rabbit, Monoclonal
Biozol Catalog Number: ABC-A306788-100
Supplier Catalog Number: A306788-100
Alternative Catalog Number: ABC-A306788-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOMM22 (Q9NS69).
Conjugation: Unconjugated
Rabbit monoclonal [ARC1688] antibody to TOMM22/TOM22.
Clonality: Monoclonal
Concentration: Lot Specific
Clone Designation: [ARC1688]
Molecular Weight: 18 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Form: Liquid
Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV
Target: TOMM22/TOM22
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:500-1:1,000