Anti-TXNRD2 Antibody [ARC1339], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306807-100
Artikelname: Anti-TXNRD2 Antibody [ARC1339], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306807-100
Hersteller Artikelnummer: A306807-100
Alternativnummer: ABC-A306807-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin reductase 2 (TXNRD2 ) (Q9NNW7).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1339] antibody to TXNRD2.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC1339]
Molekulargewicht: 56 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQA
Target-Kategorie: TXNRD2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000