Anti-TXNRD2 Antibody [ARC1339], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A306807-100
| Article Name: |
Anti-TXNRD2 Antibody [ARC1339], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A306807-100 |
| Supplier Catalog Number: |
A306807-100 |
| Alternative Catalog Number: |
ABC-A306807-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin reductase 2 (TXNRD2 ) (Q9NNW7). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC1339] antibody to TXNRD2. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC1339] |
| Molecular Weight: |
56 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQA |
| Target: |
TXNRD2 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000 |
