Anti-EIF2B5 Antibody [ARC1774], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306812-100
Artikelname: Anti-EIF2B5 Antibody [ARC1774], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306812-100
Hersteller Artikelnummer: A306812-100
Alternativnummer: ABC-A306812-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (EIF2B5) (EIF2B5) (Q13144).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1774] antibody to EIF2B5.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC1774]
Molekulargewicht: 80 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAA
Target-Kategorie: EIF2B5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200