Anti-EIF2B5 Antibody [ARC1774], Unconjugated, Rabbit, Monoclonal

Catalog Number: ABC-A306812-100
Article Name: Anti-EIF2B5 Antibody [ARC1774], Unconjugated, Rabbit, Monoclonal
Biozol Catalog Number: ABC-A306812-100
Supplier Catalog Number: A306812-100
Alternative Catalog Number: ABC-A306812-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (EIF2B5) (EIF2B5) (Q13144).
Conjugation: Unconjugated
Rabbit monoclonal [ARC1774] antibody to EIF2B5.
Clonality: Monoclonal
Concentration: Lot Specific
Clone Designation: [ARC1774]
Molecular Weight: 80 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Form: Liquid
Sequence: MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAA
Target: EIF2B5
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200