Anti-Trefoil Factor 3 Antibody [ARC2664], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306815-100
Artikelname: Anti-Trefoil Factor 3 Antibody [ARC2664], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306815-100
Hersteller Artikelnummer: A306815-100
Alternativnummer: ABC-A306815-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-80 of human TFF3 (Q07654).
Konjugation: Unconjugated
Rabbit monoclonal [ARC2664] antibody to Trefoil Factor 3.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC2664]
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Target-Kategorie: Trefoil Factor 3
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200