Anti-Trefoil Factor 3 Antibody [ARC2664], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A306815-100
| Article Name: |
Anti-Trefoil Factor 3 Antibody [ARC2664], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A306815-100 |
| Supplier Catalog Number: |
A306815-100 |
| Alternative Catalog Number: |
ABC-A306815-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-80 of human TFF3 (Q07654). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC2664] antibody to Trefoil Factor 3. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC2664] |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Target: |
Trefoil Factor 3 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
IHC: 1:50-1:200 |