Anti-TIM50 Antibody [ARC1883], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306816-100
Artikelname: Anti-TIM50 Antibody [ARC1883], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306816-100
Hersteller Artikelnummer: A306816-100
Alternativnummer: ABC-A306816-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIMM50 (Q3ZCQ8).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1883] antibody to TIM50.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC1883]
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPD
Target-Kategorie: TIM50
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200