Anti-TIM50 Antibody [ARC1883], Unconjugated, Rabbit, Monoclonal

Catalog Number: ABC-A306816-100
Article Name: Anti-TIM50 Antibody [ARC1883], Unconjugated, Rabbit, Monoclonal
Biozol Catalog Number: ABC-A306816-100
Supplier Catalog Number: A306816-100
Alternative Catalog Number: ABC-A306816-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIMM50 (Q3ZCQ8).
Conjugation: Unconjugated
Rabbit monoclonal [ARC1883] antibody to TIM50.
Clonality: Monoclonal
Concentration: Lot Specific
Clone Designation: [ARC1883]
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Form: Liquid
Sequence: MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPD
Target: TIM50
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200