Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A308100-100
Artikelname: Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A308100-100
Hersteller Artikelnummer: A308100-100
Alternativnummer: ABC-A308100-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of coronavirus SARS-CoV-2 Spike RBD (N501Y) (YP_009724390.1).
Konjugation: Unconjugated
Rabbit monoclonal [ARC52673] antibody to SARS-CoV-2 Spike Glycoprotein RBD (N501Y).
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC52673]
Molekulargewicht: 36 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG
Target-Kategorie: SARS-CoV-2 Spike Glycoprotein RBD (N501Y)
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000