Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A308100-100
| Artikelname: |
Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal |
| Artikelnummer: |
ABC-A308100-100 |
| Hersteller Artikelnummer: |
A308100-100 |
| Alternativnummer: |
ABC-A308100-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 450-550 of coronavirus SARS-CoV-2 Spike RBD (N501Y) (YP_009724390.1). |
| Konjugation: |
Unconjugated |
| Rabbit monoclonal [ARC52673] antibody to SARS-CoV-2 Spike Glycoprotein RBD (N501Y). |
| Klonalität: |
Monoclonal |
| Konzentration: |
Lot Specific |
| Klon-Bezeichnung: |
[ARC52673] |
| Molekulargewicht: |
36 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Formulierung: |
Liquid |
| Sequenz: |
NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG |
| Target-Kategorie: |
SARS-CoV-2 Spike Glycoprotein RBD (N501Y) |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:1,000-1:5,000 |
