Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A308100-100
| Article Name: |
Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A308100-100 |
| Supplier Catalog Number: |
A308100-100 |
| Alternative Catalog Number: |
ABC-A308100-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 450-550 of coronavirus SARS-CoV-2 Spike RBD (N501Y) (YP_009724390.1). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC52673] antibody to SARS-CoV-2 Spike Glycoprotein RBD (N501Y). |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC52673] |
| Molecular Weight: |
36 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG |
| Target: |
SARS-CoV-2 Spike Glycoprotein RBD (N501Y) |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:1,000-1:5,000 |
