Anti-Tubulin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80592-100
Artikelname: Anti-Tubulin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80592-100
Hersteller Artikelnummer: A80592-100
Alternativnummer: ABC-A80592-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence within amino acids 1-80 of human Alpha-tubulin (ubiquitous) chain (NP_006073.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Tubulin.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 52 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT
Target-Kategorie: Tubulin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200