Anti-Tubulin Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80592-100
Article Name: Anti-Tubulin Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80592-100
Supplier Catalog Number: A80592-100
Alternative Catalog Number: ABC-A80592-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence within amino acids 1-80 of human Alpha-tubulin (ubiquitous) chain (NP_006073.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Tubulin.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 52 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT
Target: Tubulin
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200