Anti-NFkB Inducing Kinase NIK Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A80619-100
| Artikelname: |
Anti-NFkB Inducing Kinase NIK Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A80619-100 |
| Hersteller Artikelnummer: |
A80619-100 |
| Alternativnummer: |
ABC-A80619-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 330-662 of human MAP3K14 (NP_003945.2). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to NFkB Inducing Kinase NIK. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Lot Specific |
| Molekulargewicht: |
125 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Formulierung: |
Liquid |
| Sequenz: |
KFSVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCC |
| Target-Kategorie: |
NFkB Inducing Kinase NIK |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:100-1:500 |
