Anti-NFkB Inducing Kinase NIK Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A80619-100
| Article Name: |
Anti-NFkB Inducing Kinase NIK Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A80619-100 |
| Supplier Catalog Number: |
A80619-100 |
| Alternative Catalog Number: |
ABC-A80619-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 330-662 of human MAP3K14 (NP_003945.2). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to NFkB Inducing Kinase NIK. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Molecular Weight: |
125 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
KFSVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCC |
| Target: |
NFkB Inducing Kinase NIK |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:100-1:500 |
