Anti-DNMT3B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80657-100
Artikelname: Anti-DNMT3B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80657-100
Hersteller Artikelnummer: A80657-100
Alternativnummer: ABC-A80657-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 1-100 of human DNMT3B.
Konjugation: Unconjugated
Rabbit polyclonal antibody to DNMT3B.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 96 kDa / 110 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES
Target-Kategorie: DNMT3B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC-P: 1:50-1:200, ELISA: 1 µg/ml (starting concentration)