Anti-DNMT3B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80657-100
Article Name: Anti-DNMT3B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80657-100
Supplier Catalog Number: A80657-100
Alternative Catalog Number: ABC-A80657-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 1-100 of human DNMT3B.
Conjugation: Unconjugated
Rabbit polyclonal antibody to DNMT3B.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 96 kDa / 110 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES
Target: DNMT3B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC-P: 1:50-1:200, ELISA: 1 µg/ml (starting concentration)