Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A80695-100
| Artikelname: |
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657], Unconjugated, Rabbit, Monoclonal |
| Artikelnummer: |
ABC-A80695-100 |
| Hersteller Artikelnummer: |
A80695-100 |
| Alternativnummer: |
ABC-A80695-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261). |
| Konjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0657] antibody to Glutamate Receptor 1 (AMPA subtype). |
| Klonalität: |
Monoclonal |
| Konzentration: |
Lot Specific |
| Klon-Bezeichnung: |
[ARC0657] |
| Molekulargewicht: |
102 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Formulierung: |
Liquid |
| Sequenz: |
ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL |
| Target-Kategorie: |
Glutamate Receptor 1 (AMPA subtype) |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000 |
