Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A80695-100
| Article Name: |
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A80695-100 |
| Supplier Catalog Number: |
A80695-100 |
| Alternative Catalog Number: |
ABC-A80695-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0657] antibody to Glutamate Receptor 1 (AMPA subtype). |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC0657] |
| Molecular Weight: |
102 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL |
| Target: |
Glutamate Receptor 1 (AMPA subtype) |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000 |
