Anti-MCM7/PRL Antibody [ARC0573], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80798-100
Artikelname: Anti-MCM7/PRL Antibody [ARC0573], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80798-100
Hersteller Artikelnummer: A80798-100
Alternativnummer: ABC-A80798-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0573] antibody to MCM7/PRL.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0573]
Molekulargewicht: 81 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: YTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE
Target-Kategorie: MCM7/PRL
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000