Anti-MCM7/PRL Antibody [ARC0573], Unconjugated, Rabbit, Monoclonal

Catalog Number: ABC-A80798-100
Article Name: Anti-MCM7/PRL Antibody [ARC0573], Unconjugated, Rabbit, Monoclonal
Biozol Catalog Number: ABC-A80798-100
Supplier Catalog Number: A80798-100
Alternative Catalog Number: ABC-A80798-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993).
Conjugation: Unconjugated
Rabbit monoclonal [ARC0573] antibody to MCM7/PRL.
Clonality: Monoclonal
Concentration: Lot Specific
Clone Designation: [ARC0573]
Molecular Weight: 81 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Form: Liquid
Sequence: YTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE
Target: MCM7/PRL
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000