Anti-BRCA1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80824-100
Artikelname: Anti-BRCA1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80824-100
Hersteller Artikelnummer: A80824-100
Alternativnummer: ABC-A80824-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BRCA1 (NP_009225.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to BRCA1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVG
Target-Kategorie: BRCA1
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200, ICC/IF: 1:50-1:200