Anti-BRCA1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80824-100
Article Name: Anti-BRCA1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80824-100
Supplier Catalog Number: A80824-100
Alternative Catalog Number: ABC-A80824-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BRCA1 (NP_009225.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to BRCA1.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: EYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVG
Target: BRCA1
Antibody Type: Primary Antibody
Application Dilute: IHC: 1:50-1:200, ICC/IF: 1:50-1:200