Anti-ACAP2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80935-100
Artikelname: Anti-ACAP2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80935-100
Hersteller Artikelnummer: A80935-100
Alternativnummer: ABC-A80935-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 50-160 of human ACAP2.
Konjugation: Unconjugated
Rabbit polyclonal antibody to ACAP2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 115 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: KAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILT
Target-Kategorie: ACAP2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200