Anti-ACAP2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80935-100
Article Name: Anti-ACAP2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80935-100
Supplier Catalog Number: A80935-100
Alternative Catalog Number: ABC-A80935-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC, WB
Species Reactivity: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 50-160 of human ACAP2.
Conjugation: Unconjugated
Rabbit polyclonal antibody to ACAP2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 115 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: KAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILT
Target: ACAP2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200