Anti-SFXN3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80991-100
Artikelname: Anti-SFXN3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80991-100
Hersteller Artikelnummer: A80991-100
Alternativnummer: ABC-A80991-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-80 of human SFXN3.
Konjugation: Unconjugated
Rabbit polyclonal antibody to SFXN3.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 36 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDS
Target-Kategorie: SFXN3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration)