Anti-SFXN3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80991-100
Article Name: Anti-SFXN3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80991-100
Supplier Catalog Number: A80991-100
Alternative Catalog Number: ABC-A80991-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-80 of human SFXN3.
Conjugation: Unconjugated
Rabbit polyclonal antibody to SFXN3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 36 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Form: Liquid
Sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDS
Target: SFXN3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration)