Anti-LOX Antibody [ARC0624], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81177-100
Artikelname: Anti-LOX Antibody [ARC0624], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81177-100
Hersteller Artikelnummer: A81177-100
Alternativnummer: ABC-A81177-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0624] antibody to LOX.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0624]
Molekulargewicht: 56 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Target-Kategorie: LOX
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:500-1:1,000