Anti-LOX Antibody [ARC0624], Unconjugated, Rabbit, Monoclonal

Catalog Number: ABC-A81177-100
Article Name: Anti-LOX Antibody [ARC0624], Unconjugated, Rabbit, Monoclonal
Biozol Catalog Number: ABC-A81177-100
Supplier Catalog Number: A81177-100
Alternative Catalog Number: ABC-A81177-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300).
Conjugation: Unconjugated
Rabbit monoclonal [ARC0624] antibody to LOX.
Clonality: Monoclonal
Concentration: Lot Specific
Clone Designation: [ARC0624]
Molecular Weight: 56 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Form: Liquid
Sequence: GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Target: LOX
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:500-1:1,000