Anti-ACD Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A81200-100
Artikelname: Anti-ACD Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A81200-100
Hersteller Artikelnummer: A81200-100
Alternativnummer: ABC-A81200-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-220 of human ACD.
Konjugation: Unconjugated
Rabbit polyclonal antibody to ACD.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 58 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLR
Target-Kategorie: ACD
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration)