Anti-ACD Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A81200-100
Article Name: Anti-ACD Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A81200-100
Supplier Catalog Number: A81200-100
Alternative Catalog Number: ABC-A81200-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-220 of human ACD.
Conjugation: Unconjugated
Rabbit polyclonal antibody to ACD.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 58 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Form: Liquid
Sequence: MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLR
Target: ACD
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration)