Anti-CDKN2A/p16INK4aF Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8379-100
Artikelname: Anti-CDKN2A/p16INK4aF Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8379-100
Hersteller Artikelnummer: A8379-100
Alternativnummer: ABC-A8379-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-156 of human CDKN2A/p16INK4a (NP_000068.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CDKN2A/p16INK4aF.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: QVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Target-Kategorie: CDKN2A/p16INK4aF
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200